Skip to content
  • Subscribe
  • Facebook
  • Twitter
  • Youtube
  • Instagram
  • Email
  • Home
  • News
  • Opinion
  • Entertainment
  • Features
  • Advertise
  • Subscribe to Ray’s Columns
Suburban Chicagoland

Suburban Chicagoland

Original News, Features & Opinion on local and regional news you won't find anywhere else

  • About
    • About
    • Advertise
    • Our Writers
      • Ray Hanania
      • Bill Lipinski
      • Biography: Aaron Hanania
      • Steve Metsch
      • Steve Neuhaus
    • Terms of Service
    • Privacy Policy
    • Reach Out
  • Sections
    • Events
    • Opinion
    • News
    • Features
    • Seniors
    • Comic Strip
  • Library
    • “MIdnight Flight” Online Book
      • Midnight Flight Book Overview
      • Midnight Flight Introduction
      • Midnight Flight Chapter 1
      • Midnight Flight Chapter 2
      • Midnight Flight Chapter 3
      • Midnight Flight Chapter 4
      • Midnight Flight Chapter 5
      • Midnight Flight Chapter 6
      • Midnight Flight Chapter 7
      • Midnight Flight Chapter 8
      • Midnight Flight Chapter 9
      • Midnight Flight Chapter 10
      • Midnight Flight Chapter 11
      • Midnight Flight Chapter 12
      • Midnight Flight Chapter 13
    • Villages, Cities & Towns
    • Federal Office Holders
    • County Officials
    • Legislators
  • Subscribe to Ray’s Columns
  • Comment
  • Podcast
    • Ray Hanania on Politics
    • Two Guys on Politics
    • Hanania on Tiktok
  • News Wire
  • Toggle search form
  • John Harrell and Gov. JB Pritzker and Speaker. Emanuel "Chris" Welch and other officials at ribbon cutting at new low income housing project
    Pritzker, Welch and regional leaders praise John Harrell and Black Men United for affordable housing project Civil Rights
  • Andrew Boutros US Attorney Illinois
    Former Chicago Attorney Sentenced to Two and a Half Years in Federal Prison for Tax Fraud and Witness Tampering Crime
  • Cook County Commissioner Frank Aguilar with Chicago region veterans. No one supports veterans more than Aguilar
    Cook County Commissioner Frank Aguilar honors veterans at first of monthly VetConnect Workshops at district office Cook County
  • Coffee & Conversation for the public on Wednesday, Sept. 24, 2025, featuring two speakers who will address individual fatigue and how to empower your personal health and activism.
    Orland Fire hosts Coffee & Conversation on individual fatigue and personal health Events
  • Andrew Boutros US Attorney Illinois
    Man Sentenced to a Year and a Half in Federal Prison for Covid-Relief Fraud Crime
  • Photo submitted by Jeffery M. Leving and Associates
    Leving team protected dad’s daughter from danger and restored his peace of mind Chicago
  • 05-23-25 Jeffery M. Leving
    Children of divorce caught in the middle during the holidays Blogger
  • Muslim prayer tent, O'Hare Airport Uber/Lyft Staging Area
    O’Hare Officials say they will pursue “more permanent solutions” for Muslim prayer Tent Chicago
  • Cook County Commissioner Frank Aguilar
    Cook County Commissioner Frank Aguilar Gives Update on His Work to Support Victims of July Floods in Cook County’s 16th District Cook County
  • Adel and Omar Nofal Eagle scouts, the 224th and 225th Eagle Scouts in Troop 318’s 87-year history
    Twin Brothers from Orland Park’s Troop 318 Achieve Scouting’s Highest Honor: Eagle Scout Government
  • Andrew Boutros US Attorney Illinois
    United States Attorney’s Office in Chicago Creates New Section to Prosecute Criminal Healthcare Fraud Violations Business
  • Cook County Treasurer Maria Papas
    Don’t Pay for What You Can Get for Free: How to Claim Your Property Tax Refunds  Cook County
  • 05-23-25 Jeffery M. Leving
    Dad reunited with grieving children after tragic death of mother Dads' Rights
  • Arthur Kallow CLE August 20 2025
    Leving Matrimonial Law Seminar to Address Complex Litigation Motions and Exceptions to the Hearsay Rule Arthur Kallow
  • Orland Park Mayor Jim Dodge
    Village of Orland Park Receives Clean Audit Opinion for Fiscal Year 2024 Government
Photo courtesy of the Lyons Democratic Organization

Veterans column: suicide remains a continuing problem for veterans

Posted on January 14, 2019January 14, 2019 By News Editor No Comments on Veterans column: suicide remains a continuing problem for veterans
SHARE THIS STORY
            
 
  

Veterans column: suicide remains a continuing problem for veterans

By Jerry Field

send new and events to [email protected]

There have been discussions and few actions taken on the increasing problems of post-Vietnam Veterans, specifically addressing the high degree of suicide and other related illnesses, mental, physical and social. The solutions are not easy and a proper procedure has not been discovered. A few possible solutions are available often with positive results, on an individual basis.  The results are promising, but as in most new procedures addressing physical and mental health it’s a slow process.

There was a practical solution after the Korean Conflict was drawing to a stalemate. Military being discharged or released to civilian life were given a decompression program. Most GI”s called this “Hurry up and Wait”.  The program consisted of being transferred to a National Guard or an Army Post, most likely away from a city.  Here the assignment was daily exercise, meetings, discussions and talking about what to expect when he get home.

After several days of this routine that most members of the squad were relaxed in a routine they had been accustomed for the last three to six years, The orders were issued for a  five day pass to return  home with a critical assignment. Three questions. One: What has changed since the last time you were home? Two: Will you get your old job back if you wanted it or what new profession or job are you now interested in ? The third question was not easy: What would you like to do with the rest of your life?

Photo courtesy of the Lyons Democratic Organization
Veterans Day Salute

Answering the questions was not as easy as it seemed. In the days before this assignment the squad was briefed on what was available under several Veteran programs, private agencies and to expect your executive officer or recruiter ask if you want to sign up again. There was a list of forms that we could fill out if we planned on using they GI Bill, file with the VA hospitals or health clinics and a ton of other materials. They were well prepared for their homecoming. Decompression process had started. The slow edging from standard military routine to a relaxed schedule did not take long to adjust to, but at times was difficult to understand the change to civilian life would be available soon. Some adjusted well and quickly, others needed more time. The Vietnam military in contrast, got off the bus and went directly home.

At Jesse Brown VA and Medical Center(JBVA) it was refreshing to meet an eight year Marine veteran, Alberto Lopez who also started his professional life with a desire to be a history teacher. We had something in common.. Marine Lopez took a quick change to working with two Veterans organizations. Lopez volunteered at JBVA and later while working with John Mundy, a psychologist, who understood Alberto’s efforts with Veterans, was to build some relationship of a multitude of common situations and address common problems. These opened the discussion with an effort and to seek attainable solutions and a comfortable plan to pursue the solution.

Alberto is at JBVVA every Tuesday heading up coffee hour which often is extended.  All are welcomed, no appointment is needed.  His coffee meeting is conducted at various locations you can call 773-789-9896 for the time and location.  “Just being around others who share the same situations is the start of the program. I have at my disposal a vast number of cooperating organizations, both public and private.  And my company is available to special assignments. Albert Lopez can be reached at [email protected] 773-798-9696.

NEW MILITARY SERVICE MEMBERS EMPLOYMENT RIGHTS LAW TAKES EFFECT

TheIllinoisServiceMemberEmployment&ReemploymentRightsActorISERRA(330ILCS61etseq.)wasalegislativeinitiativeofIllinoisAttorneyGeneralLisaMadigandesignedtomodernizeIllinoislawto reflect the realities of today’s operational reserve force. ISERRA garnered bi-partisan sponsorshipand support passing the General Assembly unanimously before being signed into law by the Governor this pastsummer.

Theoverchinggoalof IS E R R A istoprotectandencouragemilitaryservicewhilefacilitatingemployer compliance through assistance primarily in the form of education and training. ISERRA works to minimize disadvantages to military service in civilian careers through reemployment and benefit protections while diminishing the disruption to employers and co-workers. To accomplishthis goal, ISERRAincorporates,reconciles andreplaces,inwholeorpart,sevenstatelawswhichregulateservice memberemployment.Thisconsolidationwillgreatlysimplifycomplianceforemployers.ISERRAalso clarifies areas of ambiguity within current law including the issue of paid military leave for full-time publicemployeeswhoaremembers ofareservecomponent.

ISERRAexpandscoveragetotwonarrowgroupsofpersons.First,!SERRAprovidesbasicreemployment protections to servicein a federally recognized auxiliary of the United States Armed Forces when performingofficialdutiesinsupportofmilitaryorcivilianauthoritiesasaresultofanemergencysuchas anaturaldisaster.Second,I SERRA providesbasicreemploymentprotectionsforaperiodforwhichan employeeisabsentfromemploymentforthepurposeofmedicaltreatmentbytheUSDepartmentof Defense (not the VA) for a condition,illness, or injury sustained in the line of duty. Finally, ISERRA expands benefits to include minimum performance review protections designed to prevent poor performanceratingsduringperiodsofmilitaryleave.

For more information on ISERRA, contact the Illinois Attorney General’s office at 1-800-382-3000.

ADDITIONAL LAWS AND OTHER ACTION BY THE ILLINOIS

 LEGISLATURE WILL BE ANNOUNCED WEEK OF JANUARY 21   

Heads Up!  Agent Orange Is No Joke!

Prostate cancer is one of the 14 diseases now presumed to be caused by agent orange. Additional diseases are being processed for inclusion in this list.  There are numerous links on the web to discuss this if you Google “service-connected disability compensation for exposure to agent orange”.

I know many Vietnam Veterans, like myself, who were in safe, behind the line jobs never considered their risk for agent orange.  But it was airborne and therefore distributed over a large undefined area.  There is even action making its way through Congress to include the “blue water” Navy (ships serving off the coast of Vietnam) where agent orange is believed to have contaminated the water supplies.

Since many of the presumptive diseases result in death, it is also important that spouses and other relatives of Vietnam Vets are aware that, if the presumptive disease is noted as a partial cause of death, the surviving spouse becomes eligible for Dependents Indemnity Compensation (currently approximately $1,280 per month).

If you are a Vietnam Vet, or you know one, regardless of where they were stationed, please be sure they are aware of the scope and coverage of the agent orange compensation.

Prostate Cancer – 

One of the Agent Orange Presumptive

One of the agent orange presumptive diseases that will affect many men (and their spouses and families) as they get older is prostate cancer. Therefore, if you are diagnosed with it, step one (other than learning about the challenges you will be facing) is to file for disability compensation. The sooner you file, the sooner the compensation will begin.

As part of the new education you will begin, there is a national support organization called  UsToo  that can provide a great deal of information about Prostate Cancer and the options you’ll need to consider. Options include Active Surveillance (“wait and watch”, surgery (either traditional or robotic), and radiation (in different forms).

There are two chapters that are reasonably accessible to Lake County:

Us TOO Bill Buckman Chapter  Glenbrook Hospital, Glenview  Meetings 2nd Tuesday each Month – 7:00-9:00 pm  Contact : Peter Wiggins-Email : [email protected] Phone : 847-535-9729

ADDITIONAL LAWS AND OTHER  ACTON BY THE ILLINOIS

 LEGISLATURE WILL BE ANNOUNCED WEEK OF JANUARY 21  

newswire info
  • Author
  • Recent Posts
News Editor
News Editor
News Editor at Suburban Chicagoland
Managing Editor and News Editor for stories published in SuburbanChicagoland
News Editor
Latest posts by News Editor (see all)
  • Quick Orland Fire response prevents Marshall’s fire from spreading, no injuries - July 15, 2025
  • Suburban Chicago Man Sentenced to Two Years in Federal Prison for Threatening FEMA Employees and Law Enforcement Officers - July 12, 2025
  • Orland Fire District reports several 4th of July fires but no injuries - July 5, 2025
  • Tweet

SHARE THIS STORY
            
 
  
 
 
 
           
Baby Boomers, Veterans, Veterans Column Tags:Afghanistan, Iraq, military service, suicide, Veterans columns, Vietnam

Post navigation

Previous Post: Pritzker, Stratton host “Day of Service” to kickoff their inauguration
Next Post: Alderman Burke deserves fair treatment

Related Posts

  • US Marine Saluting. Photo courtesy of Jerry Field
    Send in the Civilians … The Marines need a little support General Topics
  • Ray Hanania
    Biased news media reinforces Trump’s popularity Baby Boomers
  • The Kennedys and the Connallys in the presidential limousine moments before the assassination in Dallas Victor Hugo King, who placed the photograph in the public domain (presumably when he gave it to the Library of Congress). Photo courtesy of Wikipedia
    “Conspiradentalism” and the murder of John F. Kennedy Baby Boomers
  • Super Bowl rejects AMVETs Ad urging players to stand during anthem News
  • U.S. Senator Bernie Sanders
    Sanders proposes to expand Medicare Baby Boomers
  • Orland Park Veterans commemorate Veterans Day. Photo courtesy of the Village of Orland Park
    Honoring Veterans this Memorial Day weekend News

More Related Articles

Midnight Flight: Chapter 6 — Alone in the Playground Baby Boomers
(U.S. Navy photo by Mass Communication Specialist 2nd Class Kelsey L. Adams/Released) Saluting Our Veterans: Elmhurst native trains in Guam News
Police officer saluting Does the Super Bowl represent our American Dream anymore? Baby Boomers
Microphone in Radio Studio, Leving Law Firm Leving team helped Dad defeat an order of protection, reuniting him with his children Arthur Kallow
Ray Hanania Ugliness in national politics won’t stop, especially against veterans Baby Boomers
Bowen High school, 2710 E 89th St., Chicago. Website banner 2017 Midnight Flight: Chapter 9 — Midnight Flight Baby Boomers

Leave a Reply Cancel reply

You must be logged in to post a comment.

Login with your Social ID
Subscribe to Ray Hanania's column graphic

Enter Your Email to Subscribe to Ray Hanania’s Columns

  • OPINION
  • 05-23-25 Jeffery M. Leving
    Children of divorce caught in the middle during the holidays
    August 27, 2025
  • Cook County Treasurer Maria Papas
    We Can Help You Understand Your Property Taxes—In Nearly Any Language
    August 8, 2025
  • Cook County Treasurer Maria Papas
    How My Office Handles Billions — And Protects Every Penny
    July 25, 2025
  • 06-04-25 Two Guys on Politics Background Zoom LOGO with images
    Video Podcast on Trump’s problems with Jeffrey Epstein, Netanyahu’s coalition in jeopardy
    July 19, 2025
  • Cook County Treasurer Maria Papas
    Everything you need to know about your Property Index Number or PIN
    July 12, 2025
  • The-Kings-Pawn-Book-300-x-300.png
  • NEWS
  • John Harrell and Gov. JB Pritzker and Speaker. Emanuel "Chris" Welch and other officials at ribbon cutting at new low income housing project
    Pritzker, Welch and regional leaders praise John Harrell and Black Men United for affordable housing project
    August 30, 2025
  • Andrew Boutros US Attorney Illinois
    Former Chicago Attorney Sentenced to Two and a Half Years in Federal Prison for Tax Fraud and Witness Tampering
    August 28, 2025
  • Cook County Commissioner Frank Aguilar with Chicago region veterans. No one supports veterans more than Aguilar
    Cook County Commissioner Frank Aguilar honors veterans at first of monthly VetConnect Workshops at district office
    August 28, 2025
  • Coffee & Conversation for the public on Wednesday, Sept. 24, 2025, featuring two speakers who will address individual fatigue and how to empower your personal health and activism.
    Orland Fire hosts Coffee & Conversation on individual fatigue and personal health
    August 28, 2025
  • Andrew Boutros US Attorney Illinois
    Man Sentenced to a Year and a Half in Federal Prison for Covid-Relief Fraud
    August 28, 2025
John Kass Columns

Order the book PoweR PR; Ethnic Activists Guide to Strategic Communications

YOUTUBE VIDEOS

CLICK TO SUBSCRIBE TO RAY HANANIA'S YOUTUBE VIDEOS


Click here to view the video on YouTube or use the widget below.

Follow Ray Hanania at
Twitter
Facebook
TitkTok
BlueSky
RayHanania Columns

Creative Commons License
All works on this website is licensed under a Creative Commons Attribution 4.0 International License. Do not edit original work. Give credit to the original source.

Categories

Copyright © 2022 Suburban Chicagoland & Urban Strategies Group

Powered by PressBook Premium theme